A0A058Z426_FONAL

Gene name A0A058Z426

Accession number A0A058Z426

Description Diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein)

Links Uniprot

Organism Fonticula alba

Length 89

>tr|A0A058Z426|A0A058Z426_FONAL Diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein) OS=Fonticula alba OX=691883 GN=H696_04444 PE=4 SV=1
MSLADKFATAEALVKKLKSRPSNDELLTIYANYKQSTVGDVDTACPGLFDVSGRAKWNAWNALKGTDKDTAMQTYVDTVDSLVQKYGTE
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy