A0A2R6QZT0_ACTCH

Gene name A0A2R6QZT0

Accession number A0A2R6QZT0

Description Trafficking protein particle complex subunit like

Links Uniprot

Organism Actinidia chinensis var. chinensis

Length 67

>tr|A0A2R6QZT0|A0A2R6QZT0_ACTCH Trafficking protein particle complex subunit like OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc12563 PE=4 SV=1
MSLQVISVRTQFMLLHDSRNDDGIKSFFQDVHELYIKILLNSLYLPGSRITSSHFDAKVRALARKYL
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy