A0A2V3IPB4_9FLOR

Gene name A0A2V3IPB4

Accession number A0A2V3IPB4

Description Mitochondrial inner membrane protease subunit 1

Links Uniprot

Organism Gracilariopsis chorda

Length 114

>tr|A0A2V3IPB4|A0A2V3IPB4_9FLOR Mitochondrial inner membrane protease subunit 1 OS=Gracilariopsis chorda OX=448386 GN=BWQ96_06295 PE=4 SV=1
MAVGPSMEPTLSARGDVLLTARMTPRAGDIVVAVKPTDADTHVVKRLVRRQRCPPHHVWLRGDNAPRSLDSRHYGAVPDALLRGVVVARLWPPRRVCGRRALRTCAAPPKHQRE
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy