E6W5N7_DESIS

Gene name E6W5N7

Accession number E6W5N7

Description Heat shock protein Hsp20

Links Uniprot

Organism Desulfurispirillum indicum (strain ATCC BAA-1389 / S5)

Length 141

>tr|E6W5N7|E6W5N7_DESIS Heat shock protein Hsp20 OS=Desulfurispirillum indicum (strain ATCC BAA-1389 / S5) OX=653733 GN=Selin_1333 PE=3 SV=1
MRYVDIFDEMDNLMRGFGNLTPMAVPASRRSGSPHGYPALNIWEDSNSFHVDVACPGVRKEDIDISVNQNMLTLEFERKQLQGDSLEYSRIESRYGKFKRNVALKADVEIDAIAASYEDGILSIAIPKAAHAKPRKIEISA
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy