K7FVG3_PELSI

Gene name K7FVG3

Accession number K7FVG3

Description Geranylgeranyl transferase type-2 subunit beta

Links Uniprot

Organism Pelodiscus sinensis

Length 331

>tr|K7FVG3|K7FVG3_PELSI Geranylgeranyl transferase type-2 subunit beta OS=Pelodiscus sinensis OX=13735 GN=RABGGTB PE=3 SV=1
MGTPQKDVVIKPDAPSTLLLEKHADYIASYGAKKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLQRMSKEEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSLHVVDVNKIVDYVKSLQKEDGSFAGDKWGEIDTRFSFCAAATLALLGKLDVIDVEKAVEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITGQLHQINADLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRCFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEDVLRRINVQPELVS
Loading...
Loading...

0 ortholog
Relationship Query & inparalogs Orthologs Orthologs length Species Taxid Taxonomy Whole Taxonomy